1μg (R: reducing condition, N: non-reducing condition).
Product Details
Product Details
Product Specification
| Species | Mouse |
| Antigen | VNN1/Vanin-1 |
| Synonyms | Pantetheinase, Tiff66, Vascular Non-Inflammatory Molecule 1 |
| Accession | Q9Z0K8 |
| Amino Acid Sequence | Leu24-Ser487, with C-terminal 8*His LDTFLAAVYEHAVILPKDTLLPVSHSEALALMNQNLDLLEGAIVSAAKQGAHIIVTPEDGIYGVRFTRDTIYPYLEEIPDPQVNWIPCDNPKRFGSTPVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQGKLVARYHKQNIFMGEDQFNVPMEPEFVTFDTPFGKFGVFTCFDILFHDPAVTLVTEFQVDTILFPTAWMDVLPHLAAIEFHSAWAMGMGVNFLAANLHNPSRRMTGSGIYAPDSPRVFHYDRKTQEGKLLFAQLKSHPIHSPVNWTSYASSVESTPTKTQEFQSIVFFDEFTFVELKGIKGNYTVCQNDLCCHLSYQMSEKRADEVYAFGAFDGLHTVEGQYYLQICILLKCKTTNLRTCGSSVDTAFTRFEMFSLSGTFGTRYVFPEVLLSEVKLAPGEFQVSSDGRLVSLKPTSGPVLTIGLFGRLYGKDWASGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-72kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Ykelien L Boersma. The structure of vanin 1: a key enzyme linking metabolic disease and inflammation. Acta Crystallogr D Biol Crystallogr. 2014 Dec 1;70(Pt 12):3320-9. Epub 2014 Nov 28. |
Background
Vanin 1, or pantetheinase, is a glycosylphosphatidylinositol(GPI)-anchored ectoenzyme that has been shown to be widely expressed in many tissues, including the liver, kidney and gut. Pantetheinase catalyzes the hydrolysis of pantetheine to pantothenic acid (vitamin B5) and cysteamine, which together with cystamine participate in the regulation of cellular pathways involved in oxidative stress and inflammation. Germline deletion of vanin 1 in mice results in an absence of tissue cysteamine. As such, vanin 1 has been shown to both protect tissues from and sensitize tissues to damage in different disease settings. Mice that lack vanin 1 display resistance to oxidative tissue damage induced by whole-body γ-irradiation, with a reduction in apoptosis and inflammation. The absence of cellular cysteamine was associated with elevated levels of the potent antioxidant glutathione.
Picture
Picture
SDS-PAGE

