Skip to product information
1 of 2

Spike RBD His Tag, SARS-CoV-2(BA.2/Omicron)

Spike RBD His Tag, SARS-CoV-2(BA.2/Omicron)

Catalog Number: S0A2043 Brand: Starter
Price:
Regular price $644.00 SGD
Regular price Sale price $644.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species SARS-CoV-2
Accession P0DTC2
Amino Acid Sequence Arg319-Phe541, with C-terminal 8*His RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 33-40kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Severe acute respiratory syndrome coronavirus 2(SARS-CoV-2) has continued to adapt for human infection and transmission, resulting in several variants of concern. While most mutations occur within a single lineage, a small number are shared across multiple variants. The SARS-CoV-2 nucleocapsid (N) gene is one hotspot for coding mutations. Nucleoproteins localize to the cytoplasm and the nucleolus, a subnuclear structure, in both virus-infected primary cells and in cells transfected with plasmids that express N protein. The coronavirus N protein is required for coronavirus RNA synthesis and has RNA chaperone activity that may be involved in template switch. Nucleocapsid protein is a highly immunogenic phosphoprotein also implicated in viral genome replication and in modulating cell signaling pathways. Because of N protein sequence and its strong immunogenicity, the N protein of coronavirus is chosen as a diagnostic tool.

The mutations are identified on the SARS-CoV-2 Omicron variant Pango lineage BA.2.

Picture

Bioactivity

Anti-His antibody Immobilized on CM5 Chip captured Spike RBD His Tag, SARS-CoV-2(BA.2/Omicron) (Cat. No. UA030028), can bind ACE2 Fc Chimera, Human (Cat. No. UA020026) with an affinity constant of 0.461 μM as determined in SPR assay (Biacore T200).

SDS-PAGE

1μg(R: reducing conditions, N: non-reducing conditions).