Skip to product information
1 of 1

SFTPD His Tag Protein, Mouse

SFTPD His Tag Protein, Mouse

Catalog Number: UA010528 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $529.00 SGD
Regular price Sale price $529.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Antigen SFTPD
Synonyms SP-D, PSP-D, SFTP4, COLEC7
Accession P50404
Amino Acid Sequence

Ala20-Phe374, with C-terminal 8*His AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEFGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 43-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Kuroki Y, Voelker DR. Pulmonary surfactant proteins. J Biol Chem. 1994;269:25943–25946.
2. Sano H, Kuroki Y. The lung collectins, SP-A and SP-D, modulate pulmonary innate immunity. Mol Immunol. 2005; 42:279–287.
3. Hu F, Ding G, Zhang Z, Gatto LA, Hawgood S, Poulain FR, et al. Innate immunity of surfactant proteins A and D in urinary tract infection with uropathogenic escherichia coli. J Innate Immun. 2015; 22:9–20.
4. Liu Z, Shi Q, Liu J, Abdel-Razek O, Xu Y, Cooney RN, et al. Innate immune molecule surfactant protein d attenuates sepsis-induced acute pancreatic injury through modulating apoptosis and NF-κB-mediated Inflammation. Sci Rep. 2015; 5:17798.
5. Stahlman MT, Gray ME, Hull WM, Whitsett JA. Immunolocalization of surfactant protein-D (SP-D) in human fetal, newborn, and adult tissues. J Histochem Cytochem. 2002;50:651–660.

Background

Surfactant Protein D (SP-D, gene name: SFTPD) is a pattern recognition molecule belonging to the family of collections expressed in multiple human organ systems, including the lungs. SFTPD is located at the genomic position 10q22.2‐23.1. In addition to the respiratory system, SFTPD is also expressed in several other tissues/organs, such as the brain, pancreas, kidney, gut, endothelium, and reproductive system. SFTPD was initially identified to be expressed and secreted in lung alveolar epithelial type II cells and plays a crucial role in protecting the lung from inhaled microorganisms, organic antigens, and toxins by recruiting the innate immune system and consequently regulating inflammatory activities. SFTPD is a critical component of the innate immune system intrinsically linked to energy metabolism. SFTPD plays an important role in the innate immune system by binding bacteria, viruses, fungi, and parasites for clearance via opsonization in phagocytes, as well as aiding in the removal of allergens.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).