Skip to product information
1 of 1

Schistosoma japonicum GST, His tag

Schistosoma japonicum GST, His tag

Catalog Number: S0A0024 Brand: Starter
Price:
Regular price $110.00 SGD
Regular price Sale price $110.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Schistosoma japonicum
Synonyms GST 26, Sj26 antigen, SjGST
Accession P08515
Amino Acid Sequence

Protein sequence(P08515, Met1-Lys218, with C-10*His)
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 25.4kDa Actual: 25kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Glutathione S-transferases are a family of eukaryotic and prokaryotic phase II metabolic isozymes best known for their ability to catalyze the conjugation of the reduced form of glutathione to xenobiotic substrates for the purpose of detoxification. The GST family consists of three super-families: the cytosolic, mitochondrial, and microsomal (also known as MAPEG proteins). Based on their biochemical, immunologic and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta.

Picture

SDS-PAGE

2μg (R: reducing conditions)