Skip to product information
1 of 1

SARS-CoV-2 (JN.1/Omicron) RBD (V483del), His tag

SARS-CoV-2 (JN.1/Omicron) RBD (V483del), His tag

Catalog Number: S0A2072 Brand: Starter
Price:
Regular price $194.00 SGD
Regular price Sale price $194.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species SARS-CoV-2
Synonyms Spike glycoprotein, E2, Peplomer protein
Accession P0DTC2
Amino Acid Sequence

Protein sequence (P0DTC2, Arg319-Lys537, with C-10*His) RVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIKGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYWYRSFRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26.5 kDa Observed MW: 33-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

There are many variants of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the virus that causes coronavirus disease 2019 (COVID-19). BA.2.86 was designated as a variant under monitoring by the World Health Organization on 17 August 2023. JN.1 (sometimes referred to as "Pirola"), a subvariant of BA.2.86 Omicron, emerged during August 2023 in Luxembourg. On 19 December 2023, JN.1 was declared by the WHO to be a variant of interest independently of its parent strain BA.2.86, but overall risk for public health was determined as low. Sars-cov-2 infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

Picture

Bioactivity

Immobilized Human ACE2, hFc tag (S0A0071) at 4 μg/mL (50 μL/well) can bind SARS-CoV-2 (JN.1/Omicron) RBD (V483del), His tag with EC50 of 31.59-42.34 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)