Skip to product information
1 of 2

SARS-CoV-2 (BQ.1.1/Omicron) RBD, His tag

SARS-CoV-2 (BQ.1.1/Omicron) RBD, His tag

Catalog Number: S0A2021 Brand: Starter
Price:
Regular price $177.00 SGD
Regular price Sale price $177.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species SARS-CoV-2
Accession P0DTC2
Amino Acid Sequence

Protein sequence(P0DTC2, Arg319-Lys537, with C-10*His)
RVQPTESIVRFPNITNLCPFDEVFNATTFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSTVGGNYNYRYRLFRKSKLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 26.3kDa Actual: 33kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

Picture

Bioactivity

Immobilized SARS-CoV-2 (BQ.1.1/Omicron) RBD, His tag at 4 μg/mL (50 μL/well) can bind Human ACE2/ACEH Protein with EC50 of 14.63-18.37 ng/mL.

SDS-PAGE

2μg (R: reducing conditions)