Immobilized SARS-CoV-2 (BA.4&BA.5/Omicron) RBD, His Tag at 4 μg/mL (50 μL/well) can bind Human ACE2, hFc tag (S0A0071) with EC50 of 20.33-31.67 ng/ml.
Product Details
Product Details
Product Specification
Species | SARS-CoV-2 |
Accession | P0DTC2 |
Amino Acid Sequence | RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH |
Expression System | HEK293 |
Molecular Weight | 35 kDa |
Purity | >95% |
Endotoxin | <0.1EU/μg |
Conjugation | Unconjugated |
Physical Appearance | Lyophilized Powder |
Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.
Picture
Picture
Bioactivity

SDS-PAGE

2μg(R: reducing conditions)

