Skip to product information
1 of 1

Rat C5a Protein, His tag

Rat C5a Protein, His tag

Catalog Number: S0A0172 Reactivity: Rat Conjugation: Unconjugated Brand: Starter
Price:
Regular price $111.00 SGD
Regular price Sale price $111.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Rat
Synonyms Complement C5, C5a anaphylatoxin
Accession P08650
Amino Acid Sequence

Protein sequence (P08650, Asp679-Arg755, with C-His tag) DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR

Expression System HEK293
Molecular Weight Predicted MW: 10.7 kDa Observed MW: 10.7 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

C5a anaphylatoxin is a potent inflammatory mediator in the complement system. It is generated during the cleavage of complement component C5. With a relatively small molecular weight, C5a possesses remarkable biological activities. It acts as a chemoattractant, drawing various immune cells like neutrophils, monocytes, and eosinophils to the site of inflammation. Additionally, C5a can activate these immune cells, enhancing their phagocytic ability and promoting the release of inflammatory cytokines and chemokines. Moreover, C5a plays a role in increasing vascular permeability, which facilitates the migration of immune cells and plasma proteins from the bloodstream to the inflamed tissue. Dysregulation of C5a has been implicated in numerous inflammatory and autoimmune diseases, making it a crucial target for therapeutic interventions.

Picture

SDS-PAGE

2μg(R: reducing conditions)