Skip to product information
1 of 2

PlGF-2/PLGF/PGF Protein, Mouse

PlGF-2/PLGF/PGF Protein, Mouse

Catalog Number: UA040136 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $282.00 SGD
Regular price Sale price $282.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms PGF, PLGF, PlGF2, PlGF, PGFL, SHGC-10760
Accession P49764-1
Amino Acid Sequence

Val19-Pro158, with C-terminal 8*His VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 25-33kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Review ProgRetin Eye Res.2019 Mar;69:116-136.Epub 2018 Oct 30.

Background

Placental growth factor (PGF), also known as vascular endothelial growth factor-related proteins PLGF and PlGF2, is a member of the vascular endothelial growth factor (VEGF) family. PlGF is a three-dimensional structure composed of 149 amino acids. PlGF is a dimeric glycoprotein formed by a 69kD α chain and a 34kD β chain connected by disulfide bond, with a unique cystine junction. These junctions are characterized by eight spatially conserved cysteines that are involved in intramolecular and intermolecular disulfide bond formation. PlGF is a pleiotropic factor affects different cell types and regulates various biological responses.PGF is not only activated during angiogenesis and endothelial cell growth, stimulating their proliferation and migration, but also promoting cell tumor growth.

Picture

Bioactivity

Measured in a cell proliferation assay using Balb/c 3T3 mouse fibroblast cells, the EC50 for this effect is less than 5ng/ml.

SDS-PAGE

2μg (R: reducing condition, N: non-reducing condition).