PD-L1 Fc Chimera Protein, Human
PD-L1 Fc Chimera Protein, Human
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Programmed Cell Death 1 Ligand 1, PD-L1, PDCD1 Ligand 1, Programmed Death Ligand 1, B7 Homolog 1, B7-H1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1 |
| Accession | Q9NZQ7 |
| Amino Acid Sequence |
Q9NZQ7, Phe19-Arg238, with C- hIgG1 Fc FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
|
| Expression System | HEK293 |
| Molecular Weight | 65-70 kDa (Reducing) |
| Purity | ＞95%, by SDS-PAGE under reducing conditions |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.2, 5% trehalose |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
PD-L1, also known as B7-H1 and CD274, is a 290 amino acid transmembrane glycoprotein in the B7 family of immune regulatory molecules. It has an extracellular domain that can interact with PD-1, which belongs to the CD28/CTLA4 family expressed on activated lymphoid cells. The PD1/PD-L1 interaction ensures that activation of the immune system occurs at the appropriate time. This will minimize the possibility of chronic autoimmune inflammation. PD-L1 is known to inhibit proliferation of T cells via apoptosis. It also plays an important role in arresting cell-cycle progression. This makes PD-L1 an attractive therapeutic target for cancer and immunologic diseases.
Picture
Picture
SDS-PAGE
ELISA
Immobilized PD-1 His Tag, Human (Cat. No. abs05023) at 1.5μg/mL (100μL/well) can bind PD-L1 Fc Chimera, Human(Cat. No. abs05024) with an EC50 of 0.142-0.174µg/mL.
Immobilized PD-1 His Tag, Cynomolgus (Cat. No. UA010311) at 2.0μg/mL (100μL/well) can bind PD-L1 Fc Chimera, Human (Cat. No. UA010003) with EC50 of 0.048-0.063μg/ml.
SPR
PD-L1 His Tag, Human (Cat. No.UA010001) captured on CM5 chip via anti-His antibody, can bind PD-1 Fc Chimera, Human (Cat. No. UA010002) with an affinity constant of 0.1836 μM as determined in a SPR assay (Biacore T200).
Loaded PD-L1 Fc Chimera, Human (Cat. No. UA010003) on Protein A Biosensor, can bind PD-1 His Tag, Human (Cat. No. UA010004) with an affinity constant of 1.6 μM as determined in BLI assay.
Protein A Chip captured PD-L1 Fc Chimera, Human (Cat. No. UA010003), can bind PD-1 His Tag, Cynomolgus (Cat. No. UA010311) with an affinity constant of 0.78 μM as determined in SPR assay.
