Skip to product information
1 of 1

Mycobacterium tuberculosis fbpA/Ag85A Protein, His Tag

Mycobacterium tuberculosis fbpA/Ag85A Protein, His Tag

Catalog Number: S0A0200 Brand: Starter
Price:
Regular price $129.00 SGD
Regular price Sale price $129.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Synonyms Diacylglycerol acyltransferase/mycolyltransferase Ag85A, DGAT, Acyl-CoA:diacylglycerol acyltransferase, Antigen 85 complex A (85A; Ag85A), Fibronectin-binding protein A (Fbps A), mpt44, MT3911
Accession P9WQP2
Amino Acid Sequence

Protein sequence (P9WQP2, Phe44-Ala338, with N-His Tag) FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA

Expression System HEK293
Molecular Weight Predicted MW: 33.3 kDa Observed MW: 33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ag85A, a member of the Antigen 85 complex, is a pivotal mycolyltransferase secreted by Mycobacterium tuberculosis and other mycobacteria. This enzyme is essential for constructing the unique, impermeable mycobacterial cell wall. It catalyzes the transfer of mycolic acids—long-chain fatty acids critical for pathogenicity—onto the arabinogalactan layer of the cell envelope, forming a protective lipid barrier. Ag85A also exhibits diacylglycerol acyltransferase activity, contributing to trehalose dimycolate (cord factor) synthesis. As one of the most abundant and immunodominant proteins secreted by the bacillus, Ag85A is a major target of the host immune response and a leading candidate for subunit vaccines against tuberculosis.

Picture

SDS-PAGE

2μg(R: reducing conditions)