Skip to product information
1 of 1

Mouse VEGF-A Protein, His Tag

Mouse VEGF-A Protein, His Tag

Catalog Number: S0A4075 Brand: Starter
Price:
Regular price $170.00 SGD
Regular price Sale price $170.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms VEGF164, Vascular permeability factor (VPF), VEGF-1, VEGF164
Accession Q00731-2
Amino Acid Sequence

Protein sequence (Q00731-2, Ala27-Arg190, with N-His tag) APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Expression System HEK293
Molecular Weight Predicted MW: 21 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

VEGFA is a key signaling protein that stimulates angiogenesis (blood vessel formation) and vascular permeability. Produced by various cell types, it binds to receptors VEGFR-1 and VEGFR-2, promoting endothelial cell proliferation, migration, and survival. Overexpressed in tumors, VEGFA supports cancer growth and metastasis by enhancing blood supply. It is a major target in anti-angiogenic cancer therapies, with drugs like bevacizumab (Avastin) blocking its activity. VEGFA also plays critical roles in wound healing and inflammatory diseases.

Picture

Bioactivity

Immobilized Mouse VEGF-A Protein, His Tag at 2 μg/mL (100 μL/well) can bind Recombinant Mouse VEGFR2 (C-Fc) with EC50 of 10-13 ng/ml.

SDS-PAGE

2μg(R: reducing conditions; NR: non-reducing conditions)