Skip to product information
1 of 1

Mouse TMEM119 , His tag

Mouse TMEM119 , His tag

Catalog Number: S0A0043 Brand: Starter
Price:
Regular price $131.00 SGD
Regular price Sale price $131.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Osteoblast induction factor (OBIF)
Accession Q8R138
Amino Acid Sequence

Protein sequence(Q8R138, Thr100-Val280, with C-10*His)

TFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:20.8kDa Actual: 28kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

TMEM119 is known as a microglia-specific and robustly expressed trans-membranous molecule, which is not expressed by other macrophages and immune or neuronal cells, and forms, therefore, the most promising microglia marker to date. TMEM119 has served as a reliable immunohistochemical microglia marker for neurodegenerative diseases since then and was recently stained by an adapted protocol for immunocytochemistry even in postmortem CSF samples of trauma cases.

Picture

SDS-PAGE

2μg(R: reducing conditions)