Skip to product information
1 of 1

Mouse TL1A/TNFSF15 Protein, His tag

Mouse TL1A/TNFSF15 Protein, His tag

Catalog Number: S0A4073 Reactivity: Mouse Conjugation: Unconjugated Brand: Starter
Price:
Regular price $177.00 SGD
Regular price Sale price $177.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, Tl1, Vegi
Accession Q5UBV8
Amino Acid Sequence

Protein sequence (Q5UBV8, Ile76-Leu252, with N-His tag) ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 21.6 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Tnfsf15, also known as tumor necrosis factor - like weak inducer of apoptosis (TWEAK), is a member of the tumor necrosis factor (TNF) superfamily. It is a type II transmembrane protein that can be cleaved to release a soluble form. Tnfsf15 plays important roles in various physiological and pathological processes. It regulates cell survival, proliferation, and migration by binding to its receptor, Fn14. In the immune system, Tnfsf15 is involved in inflammation and immune cell activation. It also participates in tissue remodeling and angiogenesis. Dysregulation of Tnfsf15 has been associated with several diseases, including cancer, autoimmune diseases, and cardiovascular diseases.

Picture

SDS-PAGE

2μg(R: reducing conditions)