Skip to product information
1 of 1

Mouse Rig-I/DDX58 Protein, hFc tag

Mouse Rig-I/DDX58 Protein, hFc tag

Catalog Number: S0A0152 Reactivity: Mouse Conjugation: Unconjugated Brand: Starter
Price:
Regular price $359.00 SGD
Regular price Sale price $359.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Antiviral innate immune response receptor RIG-I, ATP-dependent RNA helicase DDX58, DEAD box protein 58, RIG-I-like receptor 1 (RLR-1), RNA sensor RIG-I, Retinoic acid-inducible gene 1 protein (RIG-1), Retinoic acid-inducible gene I protein (RIG-I), Rigi, Ddx58
Accession Q6Q899
Amino Acid Sequence

Protein sequence (Q6Q899, Ser240-Leu450, with C-hFc tag) SPLKPRNYQLELALPAKKGKNTIICAPTGCGKTFVSLLICEHHLKKFPCGQKGKVVFFANQIPVYEQQATVFSRYFERLGYNIASISGATSDSVSVQHIIEDNDIIILTPQILVNNLNNGAIPSLSVFTLMIFDECHNTSKNHPYNQIMFRYLDHKLGESRDPLPQVVGLTASVGVGDAKTAEEAMQHICKLCAALDASVIATVRDNVAEL

Expression System HEK293
Molecular Weight Predicted MW: 49.2 kDa Observed MW: 56 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

RIG-I (retinoic acid-inducible gene I) is a cytosolic pattern recognition receptor (PRR) that can mediate induction of a type-I interferon (IFN1) response. RIG-I is an essential molecule in the innate immune system for recognizing cells that have been infected with a virus. These viruses can include West Nile virus, Japanese Encephalitis virus, influenza A, Sendai virus, flavivirus, and coronaviruses. RIG-I is an ATP-dependent DExD/H box RNA helicase that is activated by immunostimulatory RNAs from viruses as well as RNAs of other origins. RIG-I recognizes short double-stranded RNA (dsRNA) in the cytosol with a 5' tri- or di-phosphate end or a 5' 7-methyl guanosine (m7G) cap (cap-0), but not RNA with a 5' m7G cap having a ribose 2′-O-methyl modification (cap-1).

Picture

SDS-PAGE

2μg(R: reducing conditions)