Skip to product information
1 of 1

Mouse OX40L receptor, His tag

Mouse OX40L receptor, His tag

Catalog Number: S0A4036 Brand: Starter
Price:
Regular price $144.00 SGD
Regular price Sale price $144.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms OX40 antigen, OX40L receptor, CD134, Ox40, Txgp1
Accession P47741
Amino Acid Sequence

Protein sequence (P47741, Val20-Pro211, with C-10*His) VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 23 kDa Observed MW: 43-55 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), also known as CD134 and OX40 receptor, is a member of the TNFR-superfamily of receptors which is not constitutively expressed on resting naive T cells, unlike CD28. OX40 is a secondary co-stimulatory immune checkpoint molecule, expressed after 24 to 72 hours following activation; its ligand, OX40L, is also not expressed on resting antigen presenting cells, but is following their activation. Expression of OX40 is dependent on full activation of the T cell; without CD28, expression of OX40 is delayed and of fourfold lower levels. OX40 binds TRAF2, 3 and 5 as well as PI3K by an unknown mechanism. OX40 has been implicated in the pathologic cytokine storm associated with certain viral infections, including the H5N1 bird flu. An anti-OX40 antibody GSK3174998 has started clinical trials as a cancer treatment.

Picture

Bioactivity

Immobilized Mouse OX40L receptor, His tag at 2 μg/mL (100 μL/well) can bind Recombinant Mouse OX40L (N-Fc) with EC50 of 5.2-6.9 ng/mL.

SDS-PAGE

2 μg(R: reducing conditions)