Skip to product information
1 of 1

Mouse IgG2C, His tag

Mouse IgG2C, His tag

Catalog Number: S0A0104 Brand: Starter
Price:
Regular price $155.00 SGD
Regular price Sale price $155.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Immunoglobulin heavy constant gamma 2C, Ighg2c
Accession F6TQW2
Amino Acid Sequence

Protein sequence (F6TQW2, Ile97-Ser330, with C-His tag) IEPRVPITQNPCPPLKECPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERGSLFACSVVHEGLHNHLTTKTIS

Expression System HEK293
Molecular Weight Predicted MW: 27.8 kDa Observed MW: 26, 30, 34 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. In mice, the IgG subclasses are defined as IgG1, IgG2a/c, IgG2b, and IgG3. The IgG2c allele is expressed (instead of IgG2a) in certain inbred mouse strains, e.g., C57BL/6, C57BL/10, SJL, and NOD.

Picture

SDS-PAGE

2 μg(R: reducing conditions)