Skip to product information
1 of 1

Mouse IgG kappa, His tag

Mouse IgG kappa, His tag

Catalog Number: S0A0081 Brand: Starter
Price:
Regular price $340.00 SGD
Regular price Sale price $340.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Ig kappa chain C region MOPC 21
Accession P01837
Amino Acid Sequence

Protein sequence (P01837, Arg1-Cys107, with C-10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.6 kDa Observed MW: 13.6 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin kappa constant, also known as IGKC, is a gene that encodes the constant domain of kappa-type light chains for antibodies. The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). A typical antibody is composed of two immunoglobulin (Ig) heavy chains and two Ig light chains. kappa (κ) chain is one of the two types of light chain in humans. A free light chains test measures the amount of lambda and kappa free light chains in the blood. If the amount of free light chains is higher or lower than normal, it can mean you have a disorder of the plasma cells. These include multiple myeloma, a cancer of plasma cells, and amyloidosis, a condition that causes a dangerous buildup of proteins in different organs and tissues.

Picture

SDS-PAGE

2 μg(R: reducing conditions)