Skip to product information
1 of 1

Mouse CXCL10/IP-10/CRG-2 Protein

Mouse CXCL10/IP-10/CRG-2 Protein

Catalog Number: S0A4067 Reactivity: Mouse Conjugation: Unconjugated Brand: Starter
Price:
Regular price $359.00 SGD
Regular price Sale price $359.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein (Gamma-IP10; IP-10), C7, Interferon-gamma induced protein CRG-2, Small-inducible cytokine B10, Crg2, Ifi10, Inp10, Scyb10
Accession P17515
Amino Acid Sequence

Protein sequence (P17515, Ile22-Pro98) IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Expression System HEK293
Molecular Weight Predicted MW: 8.7 kDa Observed MW: 10 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

C-X-C motif chemokine 10 is a small cytokine belonging to the CXC chemokine family. CXCL10 is secreted by several cell types in response to IFN-γ. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes/macrophages, T cells, NK cells, and dendritic cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL9, CXCL10 and CXCL11 have proven to be valid biomarkers for the development of heart failure and left ventricular dysfunction, suggesting an underlining pathophysiological relation between levels of these chemokines and the development of adverse cardiac remodeling.

Picture

SDS-PAGE

2μg(R: reducing conditions)