Skip to product information
1 of 1

Mouse Complement C3a Protein, His Tag

Mouse Complement C3a Protein, His Tag

Catalog Number: S0A0191 Brand: Starter
Price:
Regular price $91.00 SGD
Regular price Sale price $91.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms HSE-MSF, Complement C3 alpha chain,
Accession P01027
Amino Acid Sequence

Protein sequence (P01027, Ser671-Arg748, with N-His Tag) SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR

Expression System HEK293
Molecular Weight Predicted MW: 10.9 kDa Observed MW: 10.9 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Complement C3a is a small bioactive peptide (77 amino acids) derived from the cleavage of complement component C3, a central protein in the complement system—a key part of innate immunity. C3a acts as an anaphylatoxin, binding to the C3a receptor (C3aR) on immune cells (e.g., mast cells, macrophages), triggering inflammation, chemotaxis, and cytokine release. It enhances immune responses against pathogens but can also contribute to inflammatory diseases (e.g., sepsis, asthma) if dysregulated. C3a also modulates tissue repair and metabolic processes, highlighting its dual role in immunity and homeostasis. Its functions are tightly regulated by the carboxypeptidase-mediated inactivation to C3a-desArg.

Picture

SDS-PAGE

2μg(R: reducing conditions)