Skip to product information
1 of 1

Mouse CEBPD Protein, hFc tag

Mouse CEBPD Protein, hFc tag

Catalog Number: S0A1147 Reactivity: Mouse Conjugation: Unconjugated Brand: Starter
Price:
Regular price $245.00 SGD
Regular price Sale price $245.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms CCAAT/enhancer-binding protein delta, C/EBP delta, C/EBP-related protein 3, Cebpd, Crp3
Accession Q00322
Amino Acid Sequence

"Protein sequence (Q00322, Ser2-Arg268, with N-hFc tag) SAALFSLDSPVRGTPWPTEPAAFYEPGRVDKPGRGPEPGDLGELGSTTPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAAGAGGLELLQGGPTRPPGVGSVARGPLKREPDWGDGDAPGSLLPAQVAVCAQTVVSLAAAAQPTPPTSPEPPRGSPGPSLAPGTVREKGAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKKLPSPPFLPPTGADCR"

Expression System HEK293
Molecular Weight Predicted MW: 54.6 kDa Observed MW: 45-90 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CCAAT/enhancer-binding protein delta is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. CEBPD is involved in regulation of apoptosis and cell proliferation. It probably acts as tumor suppressor. One study in mice showed that CEBPD prevents development of tubular injury and tubulointerstitial fibrogenesis during the progression of chronic obstructive nephropathy.

Picture

SDS-PAGE

2μg(R: reducing conditions)