Skip to product information
1 of 2

Monkeypox virus E8L, His tag

Monkeypox virus E8L, His tag

Catalog Number: S0A2018 Brand: Starter
Price:
Regular price $387.00 SGD
Regular price Sale price $387.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species MPXV
Accession Q8V4Y0
Amino Acid Sequence

Protein sequence(Q8V4Y0, Met1-Thr275, with C-10*His)
MPQQLSPINIETKKAISDTRLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIFLQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPVRENYFMKWLSDLREACFSYYQKYIEGNKTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 33.5kDa Actual: 37kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Monkeypox is a rare disease similar to smallpox caused by the monkeypox virus. It’s found mostly in areas of Africa, but has been seen in other regions of the world. It causes flu-like symptoms such as fever and chills, and a rash that can take weeks to clear. There’s no proven treatment for monkeypox, but it usually goes away on its own.Monkeypox Virus E8L binds to chondroitin sulfate on the cell surface to provide virion attachment to target cell.

Picture

Bioactivity

Immobilized Monkeypox virus E8L, His tag at 10 μg/mL (50 μL/well) can bind Monkeypox virus(MPXV E8L) Recombinant Human mAb (S0B0001) with EC50 of 26.51-33.84 ng/mL.

SDS-PAGE

2μg(R: reducing conditions)