Skip to product information
1 of 1

IgG2b Fc (Glu97-Lys335) Protein, Mouse

IgG2b Fc (Glu97-Lys335) Protein, Mouse

Catalog Number: UA050006 Application: Isotype control Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $168.00 SGD
Regular price Sale price $168.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Accession P01867-2
Amino Acid Sequence

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGL

Expression System HEK293
Molecular Weight 32-35 kDa(reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is the main antibody component in normal human serum, which is produced and secreted by B cells. It is a molecule with a molecular weight of about 150kDa. IgG contains two heavy chains (50kDa) and two light chains (25kDa), which are connected by disulfide bonds. After cleavage by pepsin, IgG is divided into F (ab) s with an antigen binding site and a highly conserved Fc fragment. The Fc fragment has a highly conserved n-glycosylation site. There are 5 subtypes of IgG in mice (IgG1, IgG2a, IgG2b, IgG2c and IgG3) and 4 subtypes in rats (IgG1, IgG2a, IgG2b and IgG2c). Some studies have found that IgG2a is superior to IgG1 in activating complements. IgG2 is mainly used to neutralize antigen or block the binding of receptor ligand. In addition, human  EGFR antibody IgG2 can mediate ADCC effect through myeloid cells. 

Picture

SDS-PAGE

IgG2b Fc (Glu97-Lys335), Mouse,1μg on SDS-PAGE under reducing and Non-reducing condition. The purity is greater than 95%.

SEC-HPLC

RP-HPLC