Skip to product information
1 of 5

IgG1 Fc Protein, Human

IgG1 Fc Protein, Human

Catalog Number: UA050001 Application: Isotype control Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $170.00 SGD
Regular price Sale price $170.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms IgG1 Fc;g gamma-1 chain C region,IGHG1
Accession P01857-1
Amino Acid Sequence

EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

32-34 KDa(Reducing)

Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4, 5% trehalose
Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fc is a crystallizable fragment composed of the carboxyl terminal of two kinds of immunoglobulin heavy chain, which is connected to each other by disulfide bond. The Fc fragment contains the carboxyl terminal part of the heavy chain fixation region, which is responsible for the effect function of immunoglobulin (complement fixation, binding to the cell membrane through Fc receptors, and placental transport). It is reported that IgG1 Fc, as a potential anti-inflammatory drug, plays a new role in the treatment of human autoimmune diseases.

Picture

SDS-PAGE

IgG1 Fc, Human ,2μg on SDS-PAGE under reducing and Non-reducing condition. The purity is greater than 95%.

RP-HPLC

ELISA

Immobilized Biotinylated FcγRIIa/CD32a(H167) Avi&His Tag, Human (Cat. No. UA010430) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind IgG1 Fc, Human (Cat. No. UA050001) with EC50 of 0.38-0.44 μg/ml.

Immobilized Biotinylated FcγRIIA/CD32a(R167) His&Avi Tag, Human(Cat. No. UA010748) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind IgG1 Fc, Human (Cat. No. UA050001) with EC50 of 0.37-0.48 μg/ml.

Immobilized Biotinylated Fc γ RIIIa/CD16a(V176) Avi&His Tag Protein, Human (Cat. No. UA010763) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind IgG1 Fc Protein, Human (Cat. No. UA050001) with EC50 of 0.46-1.14μg/ml.

SPR

Anti-His antibody Immobilized on CM5 Chip captured CD16b(NA1) His Tag, Human (Cat. No. UA020006), can bind IgG1-Fc (UA050001) with an affinity constant of 9.237 μM as determined in SPR assay (Biacore T200).