Skip to product information
1 of 1

Human VEGF 165, His tag

Human VEGF 165, His tag

Catalog Number: S0A4034 Brand: Starter
Price:
Regular price $373.00 SGD
Regular price Sale price $373.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Vascular permeability factor (VPF), VEGF
Accession P15692-4
Amino Acid Sequence

Protein sequence (P15692-4, Ala27-Arg191, with C-10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Predicted MW: 20.9 kDa Observed MW: 25 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Vascular endothelial growth factor (VEGF or VEGF-A) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the PDGF family. Humans express alternately spliced isoforms of 121, 145, 165, 183, 189, and 206 amino acids (aa) in length. VEGF165 appears to be the most abundant and potent isoform, contains basic heparin-binding regions and is not freely diffusible. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt-1) and VEGF R2 (Flk-1/KDR) on endothelial cells. VEGF165 binds the semaphorin receptor, Neuropilin-1 and promotes complex formation with VEGF R2. VEGF is required during embryogenesis to regulate the proliferation, migration, and survival of endothelial cells. In adults, VEGF functions mainly in wound healing and the female reproductive cycle. Pathologically, it is involved in tumor angiogenesis and vascular leakage. Circulating VEGF levels correlate with disease activity in autoimmune diseases such as rheumatoid arthritis, multiple sclerosis and systemic lupus erythematosus.

Picture

Bioactivity

Immobilized Human VEGF 165, His tag at 4 μg/mL (50 μL/well) can bind VEGF-R2/KDR Fc Chimera Protein, Human (Cat. No. UA010144) with EC50 of 15.4-21.0 ng/mL.

SDS-PAGE

2 μg(R: reducing conditions)