Skip to product information
1 of 1

Human VAV1 (SH3-2) Protein

Human VAV1 (SH3-2) Protein

Catalog Number: S0A9065 Brand: Starter
Price:
Regular price $548.00 SGD
Regular price Sale price $548.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Proto-oncogene vav, VAV
Accession P15498
Amino Acid Sequence

Protein sequence (P15498, Lys782-Cys845) KYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

Expression System E.coli
Molecular Weight Predicted MW: 7.6 kDa Observed MW: 10 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

VAV1 is a crucial signaling protein that belongs to the VAV family of guanine nucleotide exchange factors (GEFs). It plays a pivotal role in hematopoietic cells, where it regulates cytoskeletal dynamics, cell migration, and immune responses by activating Rho-family GTPases such as Rac1 and Cdc42. The protein contains multiple functional domains, including a Dbl homology (DH) domain for GEF activity, a pleckstrin homology (PH) domain, and two Src homology 3 (SH3) domains, with the second SH3 domain (SH3-2) mediating protein-protein interactions. VAV1 is primarily expressed in T cells, B cells, and natural killer (NK) cells, where it participates in T-cell receptor (TCR) and B-cell receptor (BCR) signaling pathways. Dysregulation of VAV1 has been linked to autoimmune diseases and hematological malignancies.

Picture

SDS-PAGE

2μg(R: reducing conditions)