Skip to product information
1 of 2

Human TNF-alpha, His Tag

Human TNF-alpha, His Tag

Catalog Number: S0A4004 Brand: Starter
Price:
Regular price $322.00 SGD
Regular price Sale price $322.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P01375
Amino Acid Sequence

VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight

19.0 kDa (reducing)

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Picture

Bioactivity

Immobilized Human TNF-alpha, His Tag at 4 μg/mL (50 μL/well) can bind Biotinylated TNFR1/CD120a/TNFRSF1A His&Avi Tag, Human (Cat. No. UA010790) with EC50 of 8.596-12.17 ng/ml.

SDS-PAGE