Skip to product information
1 of 1

Human TL1A/TNFSF15 Protein, His Tag

Human TL1A/TNFSF15 Protein, His Tag

Catalog Number: S0A4074 Brand: Starter
Price:
Regular price $111.00 SGD
Regular price Sale price $111.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI
Accession O95150
Amino Acid Sequence

Protein sequence (O95150, Leu72-Leu251, with C-His tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.2 kDa Observed MW: 22, 25, 28 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Picture

Bioactivity

Immobilized DcR3/TNFRSF6B Protein, Human (hFc) at 2 μg/mL (100 μL/well) can bind Human TNFSF15 Protein, His Tag with EC50 of 12-27.9 ng/ml.

SDS-PAGE

2μg(R: reducing conditions; NR: non-reducing conditions)