Skip to product information
1 of 1

Human TIMP2 Protein, His Tag

Human TIMP2 Protein, His Tag

Catalog Number: S0A0188 Brand: Starter
Price:
Regular price $157.00 SGD
Regular price Sale price $157.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Metalloproteinase inhibitor 2, CSC-21K, Tissue inhibitor of metalloproteinases 2 (TIMP-2)
Accession P16035
Amino Acid Sequence

Protein sequence (P16035, Cys27-Pro220, with C-His Tag) CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Expression System HEK293
Molecular Weight Predicted MW: 23.4 kDa Observed MW: 20-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TIMP2 (Tissue Inhibitor of Metalloproteinases 2) is a key regulatory protein belonging to the TIMP family, which inhibits matrix metalloproteinases (MMPs) to maintain extracellular matrix (ECM) homeostasis. By controlling MMP activity, TIMP2 plays a critical role in tissue remodeling, wound healing, and inflammation. Beyond its inhibitory function, TIMP2 exhibits MMP-independent activities, such as modulating cell growth, differentiation, and angiogenesis. It is also involved in pathological processes, including cancer progression and fibrosis, where its dysregulation contributes to ECM degradation or excessive deposition.

Picture

SDS-PAGE

2μg(R: reducing conditions)