1 1

Human Stratifin/14-3-3 sigma Protein, His Tag

Human Stratifin/14-3-3 sigma Protein, His Tag

Catalog Number: S0A6071 Brand: Starter
Share:
Price:
$131.00 SGD
$131.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin, SFN, HME1
Accession P31947
Amino Acid Sequence

Protein sequence (P31947, Met1-Ser248, with C-His Tag) MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Expression System E.coli
Molecular Weight Predicted MW: 29.5 kDa Observed MW: 30 kDa
Purity ＞95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

14-3-3 protein sigma (SFN), also known as Stratifin, is a crucial member of the 14-3-3 family. It functions as a phospho-serine/phospho-threonine binding protein that regulates a wide array of cellular processes, including cell cycle progression, apoptosis, and stress response. A key and well-characterized role of 14-3-3 sigma is its involvement in the DNA damage checkpoint, where it is transcriptionally activated by p53 and helps arrest the cell cycle. It often acts as a tumor suppressor, and its expression is frequently lost in various cancers through epigenetic silencing. Furthermore, 14-3-3 sigma is implicated in epithelial cell biology and is a significant marker in cancer research and diagnosis.

Picture

SDS-PAGE

2μg（R: reducing conditions）