Skip to product information
1 of 1

Human SFTPA2 Protein, His Tag

Human SFTPA2 Protein, His Tag

Catalog Number: S0A0195 Brand: Starter
Price:
Regular price $438.00 SGD
Regular price Sale price $438.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Pulmonary surfactant-associated protein A2, PSP-A, PSPA, SP-A, SP-A2, 35 kDa pulmonary surfactant-associated protein, Alveolar proteinosis protein, Collectin-5, COLEC5, PSAP, SFTP1, SFTPA, SFTPA2B
Accession Q8IWL1
Amino Acid Sequence

Protein sequence (Q8IWL1, Glu21-Phe248, with C-His Tag) EVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Expression System HEK293
Molecular Weight

Predicted MW: 25.8 kDa Observed MW: 33-40 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Pulmonary Surfactant-Associated Protein A2 (SP-A2) is a critical component of pulmonary surfactant, a lipoprotein complex essential for reducing surface tension in the alveoli and preventing lung collapse. Encoded by the SFTPA2 gene, it is primarily synthesized and secreted by type II pneumocytes. SP-A2 is a collectin, characterized by its collagen-like domain and carbohydrate recognition domain, which enables its key role in innate host defense. It opsonizes pathogens, enhances phagocytosis by alveolar macrophages, and modulates inflammatory responses. Genetic variants in SFTPA2 are associated with susceptibility to respiratory diseases, including pulmonary fibrosis, respiratory distress syndrome, and increased risk of severe lung infections.

Picture

SDS-PAGE

2μg(R: reducing conditions)