Skip to product information
1 of 1

Human Reg4, His tag

Human Reg4, His tag

Catalog Number: S0A0079 Brand: Starter
Price:
Regular price $222.00 SGD
Regular price Sale price $222.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Gastrointestinal secretory protein, REG-like protein, Regenerating islet-derived protein IV (Reg IV), GISP, RELP
Accession Q9BYZ8
Amino Acid Sequence

Protein sequence (Q9BYZ8, Asp23-Pro158, with C-10*His) DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 17.6 kDa Observed MW: 56-72 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Regenerating islet-derived protein 4 (Reg4) also called Reg IV or RELP (Reg-like protein), is a secreted glycoprotein belonging to the regenerating gene (Reg) family within the calcium (C‑type) dependent lectin superfamily. Reg4 expression is induced by growth factors and promotes phosphorylation and activation of the EGF R. Reg4 is preferentially expressed in the gastrointestinal (GI) tract. Reg4 expression is increased within or near inflammation, dysplasia and metaplasia of the GI epithelium, such as inflammatory bowel disease (Crohn’s disease and ulcerative colitis), colon adenocarcinoma, pancreatic cancer, gastric adenocarcinoma, and is often increased in the plasma in these conditions. It is especially associated with neuroendocrine tumors in the GI, as well as some prostate, parathyroid, skin Merkel cell and lung small-cell carcinomas. Tumor cells expressing Reg4 are generally more mitogenic, metastatic and resistant to apoptosis.

Picture

SDS-PAGE

2 μg(R: reducing conditions)