Skip to product information
1 of 1

Human PAR1 Protein, His tag

Human PAR1 Protein, His tag

Catalog Number: S0A0177 Brand: Starter
Price:
Regular price $307.00 SGD
Regular price Sale price $307.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Proteinase-activated receptor 1, PAR-1, Coagulation factor II receptor, Thrombin receptor, F2R, CF2R, PAR1, TR
Accession P25116
Amino Acid Sequence

Protein sequence (P25116, Ser42-Thr102, with C-His tag) SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT

Expression System HEK293
Molecular Weight Predicted MW: 8.8 kDa Observed MW: 15-26 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Protease-activated receptor 1 (PAR1), also known as thrombin receptor, is a member of the G-protein-coupled receptor (GPCR) family and a critical mediator of cellular responses to proteolytic enzymes, particularly thrombin. Activated by proteolytic cleavage at its N-terminal domain, PAR1 initiates signaling cascades via G proteins (e.g., Gαq/11, Gα12/13), regulating processes like platelet aggregation, vascular smooth muscle contraction, inflammation, and wound healing. Dysregulated PAR1 signaling is implicated in thrombosis, atherosclerosis, cancer cell migration, and fibrotic diseases.

Picture

SDS-PAGE

2μg(R: reducing conditions)