Skip to product information
1 of 1

Human OX40L/TNFSF4/CD252, His tag

Human OX40L/TNFSF4/CD252, His tag

Catalog Number: S0A6043 Brand: Starter
Price:
Regular price $145 USD
Regular price Sale price $145 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand (OX40L), TAX transcriptionally-activated glycoprotein 1, TXGP1
Accession P23510
Amino Acid Sequence

Protein sequence (P23510, Gln51-Leu183, with C-His tag) QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Expression System HEK293
Molecular Weight Predicted MW: 17.1 kDa Observed MW: 19-26 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

OX40L is the ligand for OX40 and is stably expressed on many antigen-presenting cells such as DC2s (a subtype of dendritic cells), macrophages, and activated B lymphocytes. The ligation of OX40-OX40L is a source of survival signal for T cells and enables the development of memory T cells. Signaling through these two molecules also leads to polarization towards Th2 immune response even in an environment with low levels of IL-4 cytokine. OX40L is also present on the surface of many non-immune cells, for example, endothelial cells and smooth muscle cells. The surface expression of OX40L is induced by many pro-inflammatory mediators, such as TNF-α, e.g. produced by mast cells, IFN-γ and PGE2. Various single-nucleotide polymorphisms (SNPs) of the OX40L gene have been identified. For some of them association with systemic lupus erythematosus has been reported.

Picture

Bioactivity

Immobilized Recombinant Human OX40 (C-Fc) at 4 μg/mL (50 μL/well) can bind Human OX40L/TNFSF4/CD252, His tag with EC50 of 3.341-4.486 ng/ ml.

Immobilized OX40/TNFRSF4/CD134 Fc Chimera, Cynomolgus (Cat. No. UA010869) at 8 μg/mL (50 μL/well) can bind Human OX40L/TNFSF4/CD252, His tag with EC50 of 10.33-14.06 ng/ ml.

SDS-PAGE

2 μg(R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)