Skip to product information
1 of 1

Human NKX2.2, His tag

Human NKX2.2, His tag

Catalog Number: S0A0063 Brand: Starter
Price:
Regular price $174.00 SGD
Regular price Sale price $174.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Homeobox protein NK-2 homolog B, NKX2.2, NKX2B
Accession O95096
Amino Acid Sequence

Protein sequence (O95096, Met1-Lys127, with C-10*His) MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 14.9 kDa Observed MW: 20-33 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Homeobox protein Nkx-2.2 is a protein that in humans is encoded by the NKX2-2 gene. Homeobox protein Nkx-2.2 contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. The expression of Nkx2-2 is regulated by an antisense RNA called Nkx2-2as. In the developing spinal cord, Nkx-2.2 regulates IRX3 thereby contributing to the proper differentiation of the ventral horn neurons.

Picture

SDS-PAGE

2μg(R: reducing conditions)