Skip to product information
1 of 1

Human MUC17, His tag

Human MUC17, His tag

Catalog Number: S0A0103 Brand: Starter
Price:
Regular price $242.00 SGD
Regular price Sale price $242.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Mucin-17, MUC-17, Small intestinal mucin-3 (MUC-3), MUC3
Accession Q685J3
Amino Acid Sequence

Protein sequence (Q685J3, Lys4120-Tyr4338, with C-His tag) KSNPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPY

Expression System HEK293
Molecular Weight Predicted MW: 26.5 kDa Observed MW: 19-30 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Mucin-17 is a protein that in humans is encoded by the MUC17 gene. Membrane mucins, such as MUC17, function in epithelial cells to provide cytoprotection, maintain luminal structure, provide signal transduction, and confer antiadhesive properties upon cancer cells that lose their apical/basal polarization. MUC17, contains an extended, repetitive extracellular glycosylation domain and a carboxyl terminus with two EGF-like domains, a SEA module domain, a transmembrane domain, and a cytoplasmic domain with potential serine and tyrosine phosphorylation sites. Interacts via its C-terminus with PDZK1 and this interaction appears important for proper localization.

Picture

SDS-PAGE

4 μg(R: reducing conditions)