Skip to product information
1 of 1

Human MIF, His tag

Human MIF, His tag

Catalog Number: S0A4030 Brand: Starter
Price:
Regular price $222.00 SGD
Regular price Sale price $222.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Glycosylation-inhibiting factor (GIF), L-dopachrome isomerase, L-dopachrome tautomerase (EC:5.3.3.12), Phenylpyruvate tautomerase, GLIF, MMIF
Accession P14174
Amino Acid Sequence

Protein sequence (P14174, Pro2-Ala115, with C-10*His) PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFAGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 14.2 kDa Observed MW: 12 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Macrophage migration inhibitory factor (MIF) is a protein that in humans is encoded by the MIF gene. MIF is an important regulator of innate immunity. The MIF protein superfamily also includes a second member with functionally related properties, the D-dopachrome tautomerase (D-DT). CD74 is a surface receptor for MIF. Bacterial antigens stimulate white blood cells to release MIF into the blood stream. The circulating MIF binds to CD74 on other immune cells to trigger an acute immune response. Hence, MIF is classified as an inflammatory cytokine. Glucocorticoids stimulate white blood cells to release MIF and hence MIF partially counteracts the inhibitory effects that glucocorticoids have on the immune system. Trauma activates the anterior pituitary gland to release MIF.

Picture

SDS-PAGE

2μg(R: reducing conditions)