Skip to product information
1 of 1

Human LAG-3 Protein, His tag

Human LAG-3 Protein, His tag

Catalog Number: S0A1131 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $323.00 SGD
Regular price Sale price $323.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Lymphocyte activation gene 3 protein, CD223, LAG3, FDC
Accession P18627
Amino Acid Sequence

Protein sequence (P18627, Leu23-Leu450, with C-His tag) LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Expression System HEK293
Molecular Weight

Predicted MW: 47.9 kDa Observed MW: 60 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Lymphocyte-activation gene 3, also known as LAG-3, is a cell surface molecule with diverse biological effects on T cell function but overall has an immune inhibitory effect. LAG3's main ligand is MHC class II, to which it binds with higher affinity than CD4. The protein negatively regulates cellular proliferation, activation, and homeostasis of T cells, in a similar fashion to CTLA-4 and PD-1 and has been reported to play a role in Treg suppressive function. LAG3 also helps maintain CD8+ T cells in a tolerogenic state and, working with PD-1, helps maintain CD8 exhaustion during chronic viral infection. LAG3 is known to be involved in the maturation and activation of dendritic cells.

Picture

Bioactivity

Immobilized Human FGL1, hFc tag (Cat. No. S0A0106) at 10 μg/mL (50 μL/well) can bind Human LAG-3 Protein, His tag with EC50 of 0.142-0.160 μg/ml.

SDS-PAGE

2 μg(R: reducing conditions)