Skip to product information
1 of 1

Human Intrinsic Factor/CBLIF Protein, His tag

Human Intrinsic Factor/CBLIF Protein, His tag

Catalog Number: S0A0173 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $196.00 SGD
Regular price Sale price $196.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Cobalamin binding intrinsic factor, Gastric intrinsic factor, Intrinsic factor (IF; INF), GIF, IFMH
Accession P27352
Amino Acid Sequence

Protein sequence (P27352, Ser19-Try417, with C-His tag) STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Expression System HEK293
Molecular Weight Predicted MW: 45.1 kDa Observed MW: 54 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cobalamin binding intrinsic factor is a glycoprotein produced by the parietal cells of the stomach. Its main function is to bind to vitamin B₁₂ (cobalamin) in the digestive tract. This binding protects cobalamin from degradation and facilitates its absorption in the ileum of the small intestine. The complex of intrinsic factor and cobalamin is recognized by specific receptors on the ileal epithelial cells, allowing for the efficient uptake of vitamin B₁₂ into the bloodstream. Deficiency of intrinsic factor can lead to pernicious anemia, as it impairs the body's ability to absorb vitamin B₁₂, which is essential for normal hematopoiesis and neurological function.

Picture

SDS-PAGE

2μg(R: reducing conditions)