Immobilized Human IL-8, His Tag at 2 μg/mL (50 μL/well) can bind IL-8 Recombinant Rabbit mAb (S-162-38) (Cat. No. S0B0698) with EC50 of 3.2-4.5 ng/mL.
Human IL-8, His Tag
Human IL-8, His Tag
Price:
Regular price
$250 USD
Regular price
Sale price
$250 USD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Accession | P10145 |
| Amino Acid Sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 10.1 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
IL-8, also known as chemokine CXCL8, is a cytokine secreted by macrophages and epithelial cells. IL-8 binds to interleukin-8 receptor α(IL8RA, also called CXCR1) and interleukin-8 receptor β(IL8RB, also known as CXCR2), resulting in cytochemotaxis neutrophils to regulate inflammatory responses. IL-8 also has a strong pro-angiogenesis effect.IL-8 is almost undetectable under physiological conditions, but under inflammatory conditions, IL-8 levels are rapidly increased by TNF-α, IL-1β and other effects. IL-8 binds to CXCR1 and CXCR2 to promote tumor growth, progression, metastasis and drug resistance through a series of mechanisms. IL-8 plays an important role in the pathogenesis of bronchitis and cystic fibrosis. This product is the recombinant human IL-8 protein expressed from human 293 cells (HEK293).
Picture
Picture
Bioactivity
SDS-PAGE
1μg（R: reducing conditions）
