Skip to product information
1 of 1

Human IL-7 Protein, His tag

Human IL-7 Protein, His tag

Catalog Number: S0A4049 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $242.00 SGD
Regular price Sale price $242.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Interleukin-7, IL7
Accession P13232
Amino Acid Sequence

Protein sequence (P13232, Asp26-His177, with C-His tag) DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Expression System HEK293
Molecular Weight Predicted MW: 19.1 kDa Observed MW: 19, 24, 28 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-7 is a hematopoietic growth factor secreted by stromal cells in the bone marrow and thymus. It is also produced by keratinocytes, dendritic cells, hepatocytes, neurons, and epithelial cells, but is not produced by normal lymphocytes. IL-7 stimulates the differentiation of multipotent (pluripotent) hematopoietic stem cells into lymphoid progenitor cells. It also stimulates proliferation of all cells in the lymphoid lineage (B cells, T cells and NK cells). It is important for proliferation during certain stages of B-cell maturation, T and NK cell survival, development and homeostasis. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL-7 could also be beneficial in improving immune recovery after allogenic stem cell transplant.

Picture

Bioactivity

Immobilized Human IL-7 Protein, His tag at 10 μg/mL (50 μL/well) can bind IL-7R alpha/CD127 Fc Chimera Protein, Human (Cat. No. UA010892) with EC50 of 27.91-39.14 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)