Human IL-6,His tag

Catalog Number: S0A4016 Brand: Starter

Price:

$242.00 SGD

Size: 10μg 25μg 50μg 100μg 500μg 1mg

Quantity:

For shipping services or bulk orders, you may request a quotation.

Secure checkout with

View full details

Product Details

Product Specification

Species	Human
Synonyms	B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2),IFNB2
Accession	P05231
Amino Acid Sequence	Protein sequence(P05231, Val30-Met212, with C-10*His) VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH
Expression System	CHO
Molecular Weight	Theoretical:22.4kDa Actual:20-23kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<1EU/μg
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution	Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage	12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. In addition, osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic.