Skip to product information
1 of 3

Human IL-6,His tag

Human IL-6,His tag

Catalog Number: S0A4016 Brand: Starter
Price:
Regular price $185 USD
Regular price Sale price $185 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2),IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence(P05231, Val30-Met212, with C-10*His)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:22.4kDa Actual:20-23kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. In addition, osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic.

Picture

Bioactivity

Immobilized Human IL-6, His tag at 10 μg/mL (50 μL/well) can bind IL-6R alpha/CD126 Fc Chimera, Human (UA010448) with EC50 of 19.56-26.66 ng/ml.

Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.2-0.4 ng/mL.

SDS-PAGE

2μg(R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)