Skip to product information
1 of 5

Human IL-6, His tag

Human IL-6, His tag

Catalog Number: S0A4011 Brand: Starter
Price:
Regular price $367.00 SGD
Regular price Sale price $367.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2)
Accession P05231
Amino Acid Sequence

Protein sequence(P05231, Val30-Met212, with C-10*His)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 22.4kDa Actual: 22-23kDa

Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Interleukin 6 (IL-6) is a prototypical cytokine for maintaining homeostasis. When homeostasis is disrupted by infections or tissue injuries, IL-6 is produced immediately and contributes to host defense against such emergent stress through activation of acute-phase and immune responses. However, dysregulated excessive and persistent synthesis of IL-6 has a pathological effect on, respectively, acute systemic inflammatory response syndrome and chronic immune-mediated diseases.

Picture

Bioactivity

The ELISA based assay shows that Human IL-6, His tag is stable at 4°C for 4 weeks.

Immobilized Human IL-6, His tag at 4 μg/mL (50 μL/well) can bind IL-6R alpha/CD126 Fc Chimera, Human (UA010448) with EC50 of 9.425-12.74 ng/ml.

The ELISA based assay shows that Human IL-6, His tag is stable after freezing and thawing 3 times.

Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.2-0.9 ng/mL.

SDS-PAGE

2μg(R: reducing conditions)