Skip to product information
1 of 1

Human IL-3, his tag

Human IL-3, his tag

Catalog Number: S0A4028 Brand: Starter
Price:
Regular price $92.00 SGD
Regular price Sale price $92.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Hematopoietic growth factor, Mast cell growth factor (MCGF), Multipotential colony-stimulating factor, P-cell-stimulating factor
Accession P08700
Amino Acid Sequence

Protein sequence (P08700, Ala20 - Phe152, with C-10*His) APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 16.8 kDa Observed MW: 18-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin 3 (IL-3) is a protein that in humans is encoded by the IL3 gene localized on chromosome 5q31.1. Sometimes also called colony-stimulating factor, multi-CSF, mast cell growth factor, MULTI-CSF, MCGF; MGC79398, MGC79399: the protein contains 152 amino acids and its molecular weight is 17 kDa. IL-3 is produced as a monomer by activated T cells, monocytes/macrophages and stroma cells. The major function of IL-3 cytokine is to regulate the concentrations of various blood-cell types. It induces proliferation and differentiation in both early pluripotent stem cells and committed progenitors. It also has many more specific effects like the regeneration of platelets and potentially aids in early antibody isotype switching.

Picture

Bioactivity

Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.2-2.3 ng/mL.

SDS-PAGE

2μg(R: reducing conditions)