Immobilized Human IL-23/IL12Bp40&IL-23Ap19, No tag&His tag at 10 μg/mL (50 μL/well) can bind Recombinant Human IL-23R Protein, hFc with EC50 of 0.287-0.393 μg/ ml.
Product Details
Product Details
Product Specification
Species | Human |
Synonyms | IL-12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40), IL-12 subunit p40, NK cell stimulatory factor chain 2 (NKSF2), NKSF2, IL-23 subunit alpha, IL-23-A, Interleukin-23 subunit p19 (IL-23p19), SGRF |
Accession | P29460、Q9NPF7 |
Amino Acid Sequence | Protein sequence1 (P29460, Ile23-Ser328) IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS; Protein sequence2 (Q9NPF7, Arg20-Pro189, with C-His tag) RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
Expression System | HEK293 |
Molecular Weight | Predicted MW: 20.4 kDa(IL-23Ap19)&34.7 kDa(IL12Bp40) Observed MW: 20, 40 kDa |
Purity | >95% by SDS-PAGE |
Endotoxin | <0.1EU/μg |
Physical Appearance | Lyophilized Powder |
Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Interleukin 23 (IL-23) is a heterodimeric cytokine composed of an IL-12B (IL-12p40) subunit (which is shared with IL-12) and an IL-23A (IL-23p19) subunit. IL-23 is part of the IL-12 family of cytokines. The functional receptor for IL-23 (the IL-23 receptor) consists of a heterodimer between IL-12Rβ1 and IL-23R. IL-23 is an inflammatory cytokine. It has been shown to be a key cytokine for T helper type 17 cell (Th17 cell) maintenance and expansion. IL-23 stabilises RORγt and thus enables Th17 cells to release their effector cytokines, such as IL-17, IL-21, IL-22 and GM-CSF, which mediate protection against extracellular fungi and bacteria and participate in barrier immunity. Natural killer cells also express the IL-23 receptor. IL-23 also induces proliferation of CD4 memory T cells. Besides its proinflammatory effects, IL-23 promotes angiogenesis. IL-23 imbalance and increase is associated with autoimmune diseases and cancer. Low concentrations of IL-23 support lung tumor growth whereas high concentrations inhibit proliferation of lung cancer cells. IL-23 and IL-23R were identified in serum from patients with non-small-cell lung cancer and have been proposed as prognostic serum markers. IL-23 can also promote progression of cardiovascular diseases such as atherosclerosis, hypertension, aortic dissection, cardiac hypertrophy, myocardial infarction and acute cardiac injury. In brain, IL-23 is able to activate γδ T cells to increase their expression of IL-17, which contributes to the inflammatory response and thus plays a key role in secondary brain injury after spontaneous intracerebral hemorrhage.
Picture
Picture
Bioactivity
SDS-PAGE
2 μg(R: reducing conditions; NR: non-reducing conditions)
