2μg(R: reducing conditions) |
Species | Human |
Synonyms | Cytokine Zcyto18, IL-10-related T-cell-derived-inducible factor (IL-TIF), ILTIF, ZCYTO18 |
Amino Acid Sequence | Protein sequence (Q9GZX6, Ala34 - Ile179, with C-10*His) APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIGGGGSHHHHHHHHHH |
Expression System | HEK293 |
Molecular Weight | Predicted MW: 18.4 kDa Observed MW: 16.5, 18-33 kDa |
Purity | >95% by SDS-PAGE |
Endotoxin | <1EU/μg |
Tag | with C-10*His |
Physical Appearance | Lyophilized Powder |
Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Interleukin-22 (IL-22) is protein that in humans is encoded by the IL22 gene. IL-22 is an α-helical cytokine. IL-22 binds to a heterodimeric cell surface receptor composed of IL-10R2 and IL-22R1 subunits. IL-22R is expressed on tissue cells, and it is absent on immune cells. IL-22 is produced by several populations of immune cells at a site of inflammation. Producers are αβ T cells classes Th1, Th22 and Th17 along with γδ T cells, NKT, ILC3, neutrophils and macrophages. IL-22 takes effect on non-hematopoietic cells – mainly stromal and epithelial cells. Effects involve stimulation of cell survival, proliferation and synthesis of antimicrobials including S100, Reg3β, Reg3γ and defensins. IL-22 thus participates in both wound healing and in protection against microbes.
2μg(R: reducing conditions) |