Skip to product information
1 of 1

Human IL-15 Protein, hFc tag

Human IL-15 Protein, hFc tag

Catalog Number: S0A4044 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $294.00 SGD
Regular price Sale price $294.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Interleukin-15, IL15
Accession P40933
Amino Acid Sequence

Protein sequence (P40933, Asn49-Ser162, with C-hFc tag) NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Expression System HEK293
Molecular Weight Predicted MW: 38.8 kDa Observed MW: 45-60 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin-15 (IL-15) is a protein that in humans is encoded by the IL15 gene. IL-15 is an inflammatory cytokine with structural similarity to Interleukin-2 (IL-2). Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is secreted by mononuclear phagocytes (and some other cells) following infection by virus(es). This cytokine induces the proliferation of natural killer cells, i.e. cells of the innate immune system whose principal role is to kill virally infected cells. IL-15 is constitutively expressed by a large number of cell types and tissues, including monocytes, macrophages, dendritic cells (DC), keratinocytes, fibroblasts, myocyte and nerve cells. As a pleiotropic cytokine, it plays an important role in innate and adaptive immunity.

Picture

Bioactivity

Immobilized Human IL-15 Protein, hFc tag at 4 μg/mL (50 μL/well) can bind Biotinylated IL-15R alpha/CD215 Fc&Avi Tag, Human (Cat. No. UA010693) with EC50 of 1.259-1.656 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)