Immobilized Human IgG4 Fc protein at 4 μg/mL (50 μL/well) can bind Staphylococcus aureus Protein A(B), His tag (Cat. No. S0A0109) with EC50 of 5.312-5.768 ng/ml.
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Immunoglobulin heavy constant gamma 4, Ig gamma-4 chain C region, IGHG4 |
| Accession | P01861 |
| Amino Acid Sequence | Protein sequence (P01861, Glu99-Gly326)ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 25.6 kDa;Observed MW: 30 kDa |
| Purity | >90% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | No Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Immunoglobulin G (IgG) is a type of antibody. Representing approximately 75% of serum antibodies in humans, IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. There are four IgG subclasses (IgG1, 2, 3, and 4) in humans, named in order of their abundance in serum. Ig gamma-4 chain C region is a protein that in humans is encoded by the IGHG4 gene. If antigen persists, high affinity IgG4 is produced, which dampens down inflammation by helping to curtail FcR-mediated processes.
Picture
Picture
Bioactivity
Immobilized Human IgG4 Fc protein at 10 μg/mL (50 μL/well) can bind Human Fc γ RIa/CD64, His tag (Cat. No. S0A1105) with EC50 of 12.72-13.34 ng/ml.
SDS-PAGE
2 μg(R: reducing conditions)
