Skip to product information
1 of 1

Human IgG4 Fc protein

Human IgG4 Fc protein

Catalog Number: S0A0110 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $111.00 SGD
Regular price Sale price $111.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Immunoglobulin heavy constant gamma 4, Ig gamma-4 chain C region, IGHG4
Accession P01861
Amino Acid Sequence

Protein sequence (P01861, Glu99-Gly326) ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG

Expression System HEK293
Molecular Weight Predicted MW: 25.6 kDa;Observed MW: 30 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. Representing approximately 75% of serum antibodies in humans, IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. There are four IgG subclasses (IgG1, 2, 3, and 4) in humans, named in order of their abundance in serum. Ig gamma-4 chain C region is a protein that in humans is encoded by the IGHG4 gene. If antigen persists, high affinity IgG4 is produced, which dampens down inflammation by helping to curtail FcR-mediated processes.

Picture

Bioactivity

Immobilized Human IgG4 Fc protein at 4 μg/mL (50 μL/well) can bind Staphylococcus aureus Protein A(B), His tag (Cat. No. S0A0109) with EC50 of 5.312-5.768 ng/ml.

Immobilized Human IgG4 Fc protein at 10 μg/mL (50 μL/well) can bind Human Fc γ RIa/CD64, His tag (Cat. No. S0A1105) with EC50 of 12.72-13.34 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)