Product Details
Product Details
Product Specification
Species | Human |
Accession | P01579 |
Amino Acid Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. |
Expression System | HEK293 |
Molecular Weight | 18.5 kDa (Reducing) |
Purity | >95% by SDS-PAGE |
Endotoxin | <1EU/μg |
Conjugation | Unconjugated |
Physical Appearance | Lyophilized Powder |
Storage Buffer | 0.2M PBS, pH7.4 |
Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
IFN-gamma, the only member of type II interferon, is a soluble dimer cytokine secreted mainly by natural killer cells (NK) and natural killer T cells (NKT) when it functions in innate immunity. During antigen-specific immunity it is secreted by CD4 Th1 and CD8 cytotoxic T cells.IFN-gamma acts on the whole process of tumorigenesis and development, and its anti-tumor mechanism is mainly divided into immune mechanism and non-immune mechanism.IFN-gamma can directly inhibit tumor cell proliferation, promote tumor cell apoptosis, inhibit tumor angiogenesis, and cooperate with NK, NKT, γδT cells and CD4+/CD8+T cells of innate and adaptive immunity to complete tumor killing. In addition, IFN-gamma also has an important immunomodulatory function, which can improve the lysosomal activity of macrophages, and has an anti-proliferation effect on transformed cells.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).
Picture
Picture
SDS-PAGE

