Skip to product information
1 of 2

Human GM-CSF, His tag

Human GM-CSF, His tag

Catalog Number: S0A4024 Brand: Starter
Price:
Regular price $66.00 SGD
Regular price Sale price $66.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Granulocyte-macrophage colony-stimulating factor, Colony-stimulating factor (CSF), Molgramostin, Sargramostim
Accession P04141
Amino Acid Sequence

Protein sequence(P04141, Ala18-Glu144, with C-10*His) APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:16.1kDa Actual:17-30kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. Unlike granulocyte colony-stimulating factor, which specifically promotes neutrophil proliferation and maturation, GM-CSF affects more cell types, especially macrophages and eosinophils. It is part of the immune/inflammatory cascade, by which activation of a small number of macrophages can rapidly lead to an increase in their numbers, a process crucial for fighting infection.

Picture

Bioactivity

2μg(R: reducing conditions)

Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 40-80 pg/mL.